IGF-1 LR3
IGF-1 LR3
Couldn't load pickup availability
IGF-1 LR3 – Research Grade Peptide
IGF-1 LR3 is a modified analog of insulin-like growth factor-1 (IGF-1) studied for its role in cellular growth, anabolic signaling, and tissue repair pathways. It is designed to have lower affinity for IGF-binding proteins than native IGF-1, which may increase biological availability in research settings.[1][2]
Product Details
- Synonyms: Long R3 IGF-1; IGF-1 LR3; Long Arg3 IGF-1
- Peptide Type: IGF-1 analog
- Sequence: MFPAMPLLSLFVNARPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Molecular Weight: 9117.60 g/mol
- CAS Number: 946870-92-4
- Solubility: Soluble in water (typically provided as acetate salt); reconstitute in sterile water or dilute acetic acid
For Research Use Only. This product is supplied for scientific research and laboratory use only, not for human or veterinary administration.
What is the purity of your peptides?
What is the purity of your peptides?
Our peptides are high-purity, research-grade products. In fact, the vast majority of our peptides have a purity level of 99% or higher (as determined by analytical testing). We ensure this by putting each batch through rigorous purification processes and quality tests. Every batch is analyzed using advanced techniques like HPLC (to measure purity) and Mass Spectrometry (to confirm molecular weight and identity).
We also have independent third-party labs verify the purity to provide an extra layer of confidence. A detailed Certificate of Analysis is maintained for each batch, so you can review the exact purity percentage and test results for your specific vial if needed.
With Stratford Peptides, you can trust that you’re getting some of the purest peptides available on the market, which is crucial for reliable research outcomes.
How are your peptides stored and shipped?
How are your peptides stored and shipped?
All our peptides are supplied as lyophilized (freeze-dried) powders, which are very stable for shipping.
We store them in optimal conditions (frozen storage) at our facility, and when we ship them to you, they are sealed in airtight vials.
Shipping: We pack orders carefully to ensure the peptides remain stable during transit. Lyophilized peptides can handle normal shipping times without issue – short exposures to ambient temperatures (a few days in shipping) do not significantly affect product integrity. For most orders, we use padded mailers or insulated packaging to protect the vials. If you order a product that is particularly temperature-sensitive, we will include appropriate cooling packs or dry ice in the package as needed. Our goal is to make sure the peptides arrive in perfect condition. Once delivered, you should place the peptides in a freezer for long-term storage (Refrigerate if you plan to use them immediately).
For more guidance on how to handle and store your peptides upon arrival, please refer to our blog or the instructions included with your order.
Do you provide Certificates of Analysis (COA)?
Do you provide Certificates of Analysis (COA)?
Yes, we provide Certificates of Analysis for our peptide products. A Certificate of Analysis is a document from our quality control lab (or an independent lab) that verifies the identity, purity, and quality of the peptide batch. It includes the results of analytical tests – for example, the HPLC purity percentage, mass spectrometry verification of the molecular weight, and other relevant data.
We maintain a COA for every batch we produce, to ensure transparency and quality assurance. If you would like the COA for a product you purchased, simply contact us or check the product page (in some cases we make them downloadable). The COA lets you see that, say, your peptide is >99% pure and matches the expected formula. This is part of our commitment to providing research, trusted peptides, you don’t have to just take our word for it; the lab results speak for themselves.
Are your peptides synthetic or naturally derived?
Are your peptides synthetic or naturally derived?
All of our peptides are synthetic, meaning they are created by chemical synthesis in a lab. We do not use peptides extracted from animal or human tissues. The synthetic route allows us to produce peptides with precise control over their sequence and purity. In modern peptide science, chemical synthesis is the preferred method for research peptides because it’s efficient and yields highly pure products. By synthesising peptides, we can also incorporate special modifications or create analogues that might not be readily found in nature, which is valuable for research.
In summary, when you purchase from Stratford Peptides, you are getting lab-synthesised peptides that are tailor-made for consistency and quality. This ensures that each batch is reproducible and free from contaminants that could be present in peptides derived from natural sources.
Share
